PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462921327
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HSF
Protein Properties Length: 127aa    MW: 13829.8 Da    PI: 4.8011
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462921327genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind68.81.1e-2152110260
                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                   Fl k++e++ed++++ ++sw +  nsfvv+d++ fa ++Lp+ Fkh nf+ F+RQLn+Y
     462921327  52 FLAKTFEMVEDPATDGVVSWGAARNSFVVWDPHAFAARLLPRRFKHANFSTFLRQLNTY 110
                   9********************999*********************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.4E-2344112IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467851.5E-2048113IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004157.6E-2048126IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.9E-1852110IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.3E-125275IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.3E-1290102IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.3E-12103115IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MENPAAVTVK QELQDDDEVV VVVQDGHCDG AAAPAPAPLE KLSAAAAAVA PFLAKTFEMV  60
EDPATDGVVS WGAARNSFVV WDPHAFAARL LPRRFKHANF STFLRQLNTY VRNQMQITLL  120
LLVITID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B6e-15381101587Heat shock factor protein 1
5d5v_B6e-15381101587Heat shock factor protein 1
5d5v_D6e-15381101587Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3727014e-71AK372701.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3009M23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150022.16e-42heat shock factor protein HSF30
TrEMBLB6TKC47e-42B6TKC4_MAIZE; Heat shock factor protein HSF30
STRINGSi006775m3e-40(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26150.12e-26heat shock transcription factor A2